DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr14

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:90/233 - (38%) Gaps:65/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PMFISRSETFKFIT--GETIVLPCEVANTDTYVVAW--KRG--IAILTAGSVKVTPDPRVRL--- 141
            |.|.....|....|  ..::.|.|.|.:.....|:|  :||  :.::|.|....:.|.|..|   
  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137

  Fly   142 -VNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQV---------- 195
             .|.:.|.|:.|...|.|.|.||:::..|..:...:.|:||          |:::          
  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVP----------HVEILDERGSATPE 192

  Fly   196 ---KKGSSVRIECSATGNPMPN--VTW----------------SRKNNILPNGEEKLHSHVLS-- 237
               |.||::.::|..:..|.|:  :||                |.|.::||       ...||  
  Fly   193 KYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLP-------GRALSRL 250

  Fly   238 -IENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPE 274
             |.|.:|...|.|.|...|.:    :..||:|||...|
  Fly   251 YIANANRQDTGNYTCMLGNEI----TETVVVHVLNGEE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 23/87 (26%)
Ig 103..177 CDD:143165 22/81 (27%)
IG_like 191..269 CDD:214653 24/111 (22%)
IGc2 198..258 CDD:197706 20/80 (25%)
I-set 273..360 CDD:254352 1/2 (50%)
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 22/79 (28%)
Ig 84..169 CDD:299845 23/84 (27%)
IG_like 191..279 CDD:214653 23/98 (23%)
Ig 201..274 CDD:143165 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.