DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and SIGLEC15

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_998767.1 Gene:SIGLEC15 / 284266 HGNCID:27596 Length:328 Species:Homo sapiens


Alignment Length:200 Identity:46/200 - (23%)
Similarity:74/200 - (37%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GETIVLPCEVANTDTY-----VVAWKRG---------------------IAILTAGSVKVTPDPR 138
            |:..||||...:...:     ...|:.|                     .|:...|..::..:||
Human    57 GDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPR 121

  Fly   139 VRLVNGFNLQIRDALPTDAGDYICQIA----TMDPREITHTVEILV--PPRIHHISTGGHLQVKK 197
               .|..:|::......|...|.|::.    ..|..|..|.|.:.|  .|||.:||    :....
Human   122 ---RNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNIS----VLPSP 179

  Fly   198 GSSVRIECSATGNPMPNVTWSRK---NNILP-NGEEKLHSHVLSIENVDRHKGGVYICTANNRVG 258
            ..:.|..|:|.|.|.|.:.||..   |::.. ....:.|.|:::.|.......|.|.|||.|.:|
Human   180 AHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLG 244

  Fly   259 QPASS 263
            :..:|
Human   245 RSEAS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/109 (18%)
Ig 103..177 CDD:143165 18/103 (17%)
IG_like 191..269 CDD:214653 19/76 (25%)
IGc2 198..258 CDD:197706 18/63 (29%)
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
SIGLEC15NP_998767.1 Ig 44..150 CDD:299845 16/95 (17%)
Ig <187..252 CDD:299845 18/62 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.