DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:134/270 - (49%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GETIVLPCEVANTDTYVVAWKRGIAILTAGSVKVTPDPRVRLVN----GFNLQIRDALPTDAGDY 160
            |:|.:|.|.|.:.:: .|||.....|:.||..|.:.||||.|..    .::|:|:.....|.|.|
Mouse    77 GDTAILRCVVEDKNS-KVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSY 140

  Fly   161 ICQIATM-DPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNIL 224
            .|.:.|. :|:.....:.:.|||:|.:||:  .:.|.:||:|.:.|.|.|.|.|.:||   .::.
Mouse   141 TCSVQTQHEPKTSQVYLIVQVPPKISNISS--DVTVNEGSNVTLVCMANGRPEPVITW---RHLT 200

  Fly   225 PNGEE-KLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGE-- 286
            |.|.| :.....|.|..:.|.:.|.|.|.|.|.|......||.:.|.:.|.|:..:    |.|  
Mouse   201 PLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK----SNEAT 261

  Fly   287 -GHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQ 350
             |.:|:|.|.......|:..|::|..::::.....:::...:.:|.:..|..:.:|||:|||.|:
Mouse   262 TGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANK 326

  Fly   351 LGKARKTLQL 360
            ||....:|.|
Mouse   327 LGVTNASLVL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/84 (30%)
Ig 103..177 CDD:143165 23/78 (29%)
IG_like 191..269 CDD:214653 25/78 (32%)
IGc2 198..258 CDD:197706 21/60 (35%)
I-set 273..360 CDD:254352 23/89 (26%)
Ig 290..359 CDD:143165 17/68 (25%)
FN3 <466..524 CDD:238020
LsampXP_030104997.1 Ig 69..159 CDD:386229 25/82 (30%)
Ig_3 163..232 CDD:372822 25/73 (34%)
Ig_3 250..325 CDD:372822 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20533
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.