DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and NEGR1

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:318 Identity:92/318 - (28%)
Similarity:146/318 - (45%) Gaps:43/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGIAILTAGSVKV 133
            |:.|...:..:||.:.               |:|.||.|.:.: .....||....:|:.||..|.
Human    37 SVDFPWAAVDNMMVRK---------------GDTAVLRCYLED-GASKGAWLNRSSIIFAGGDKW 85

  Fly   134 TPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATM-DPREITHTVEILVPPRIHHISTGGHL 193
            :.||||.:    ...::|||::...||.|.|.|.:.|. .||.:...:.:.|||:|:.||  ..:
Human    86 SVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDIS--NDM 148

  Fly   194 QVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVG 258
            .|.:|::|.:.|.|||.|.|:::|   .:|.|:.:...:...|.|..:.|.:.|.|.|:|.|.|.
Human   149 TVNEGTNVTLTCLATGKPEPSISW---RHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS 210

  Fly   259 QPASSQVVLHVLFSPEISVERPVVFSG---EGHEATLVCIVHGETQPEVIWFKDTMQLDTTERH- 319
            .|...:|.:.|.|:|.|.    .:.||   .|....:.|...|...|...|:|...:|...::. 
Human   211 FPDVRKVKVVVNFAPTIQ----EIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGI 271

  Fly   320 IMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQY 377
            |::...:|..|.:..|..:.||||:|||.|:||....:|.|         |.|..:||
Human   272 IIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPL---------NPPSTAQY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 26/84 (31%)
Ig 103..177 CDD:143165 24/78 (31%)
IG_like 191..269 CDD:214653 23/77 (30%)
IGc2 198..258 CDD:197706 19/59 (32%)
I-set 273..360 CDD:254352 26/90 (29%)
Ig 290..359 CDD:143165 20/69 (29%)
FN3 <466..524 CDD:238020
NEGR1NP_776169.2 IG 47..135 CDD:214652 28/103 (27%)
IGc2 152..210 CDD:197706 19/60 (32%)
Ig_3 225..301 CDD:372822 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.