DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Iglon5

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:345 Identity:98/345 - (28%)
Similarity:156/345 - (45%) Gaps:50/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVA 110
            ||    .|:..|.......:||:|....|.|.:         |.|.::.:....|:...|.|.: 
Mouse     6 PG----ARLRLLAAAALAGLAVISRGLLSQSLE---------FSSPADNYTVCEGDNATLSCFI- 56

  Fly   111 NTDTYV--VAWKRGIAILTAGSVKVTPDPRVRLV----NGFNLQIRDALPTDAGDYICQIATMDP 169
              |.:|  |||.....||.||:.:.|.||||||:    ..|::.|......|.|.|.|...|   
Mouse    57 --DEHVTRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQT--- 116

  Fly   170 REITHTVEIL----VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSR-KNNILPNGEE 229
            |...:|.::.    ||.||.:||:  .:.|.:|.:|.:.|.|.|.|.|.|||.: ::.....|| 
Mouse   117 RHQPYTTQVYLIVHVPARIVNISS--PVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGE- 178

  Fly   230 KLHSHVLSIENVDRHKGGVYICTANNRVGQ-PASSQVVLHVLFSP---EISVERPVVFSGEGHEA 290
                 :|.|.::.|.:.|.|.|..:|.|.. |.|.:|::.|.:.|   :::..|..:    |..|
Mouse   179 -----ILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTAL----GRAA 234

  Fly   291 TLVCIVHGETQPEVIWFKDTMQLD--TTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGK 353
            .|.|........:..|:||...|.  :.|...::|..:|..|:...|..:.:|||:|.|.|:||.
Mouse   235 LLRCEAMAVPPADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGA 299

  Fly   354 ARKTLQLSGKPNVAVFNSPP 373
            :..:::|. :|. ::.||.|
Mouse   300 SSASMRLL-RPG-SLENSAP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/89 (31%)
Ig 103..177 CDD:143165 27/79 (34%)
IG_like 191..269 CDD:214653 24/79 (30%)
IGc2 198..258 CDD:197706 19/60 (32%)
I-set 273..360 CDD:254352 23/91 (25%)
Ig 290..359 CDD:143165 20/70 (29%)
FN3 <466..524 CDD:238020
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 28/93 (30%)
Ig strand A' 41..46 CDD:409353 0/4 (0%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/6 (17%)
FR2 61..68 CDD:409353 3/6 (50%)
Ig strand C 61..67 CDD:409353 3/5 (60%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 13/34 (38%)
Ig strand D 84..91 CDD:409353 4/6 (67%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 2/6 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 3/4 (75%)
Ig_3 134..199 CDD:404760 23/72 (32%)
Ig strand A' 140..145 CDD:409353 0/6 (0%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 2/10 (20%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 20/81 (25%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.