DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Iglon5

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:345 Identity:98/345 - (28%)
Similarity:156/345 - (45%) Gaps:50/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVA 110
            ||    .|:..|.......:||:|....|.|.:         |.|.::.:....|:...|.|.: 
Mouse     6 PG----ARLRLLAAAALAGLAVISRGLLSQSLE---------FSSPADNYTVCEGDNATLSCFI- 56

  Fly   111 NTDTYV--VAWKRGIAILTAGSVKVTPDPRVRLV----NGFNLQIRDALPTDAGDYICQIATMDP 169
              |.:|  |||.....||.||:.:.|.||||||:    ..|::.|......|.|.|.|...|   
Mouse    57 --DEHVTRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQT--- 116

  Fly   170 REITHTVEIL----VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSR-KNNILPNGEE 229
            |...:|.::.    ||.||.:||:  .:.|.:|.:|.:.|.|.|.|.|.|||.: ::.....|| 
Mouse   117 RHQPYTTQVYLIVHVPARIVNISS--PVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGE- 178

  Fly   230 KLHSHVLSIENVDRHKGGVYICTANNRVGQ-PASSQVVLHVLFSP---EISVERPVVFSGEGHEA 290
                 :|.|.::.|.:.|.|.|..:|.|.. |.|.:|::.|.:.|   :::..|..:    |..|
Mouse   179 -----ILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTAL----GRAA 234

  Fly   291 TLVCIVHGETQPEVIWFKDTMQLD--TTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGK 353
            .|.|........:..|:||...|.  :.|...::|..:|..|:...|..:.:|||:|.|.|:||.
Mouse   235 LLRCEAMAVPPADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGA 299

  Fly   354 ARKTLQLSGKPNVAVFNSPP 373
            :..:::|. :|. ::.||.|
Mouse   300 SSASMRLL-RPG-SLENSAP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/89 (31%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 3/5 (60%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 28/88 (32%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 2/3 (67%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 20/80 (25%)
FN3 <466..524 CDD:238020
Iglon5NP_001157990.1 Ig 41..129 CDD:472250 28/93 (30%)
Ig strand B 50..54 CDD:409382 1/3 (33%)
Ig strand C 62..66 CDD:409382 2/3 (67%)
Ig strand E 95..99 CDD:409382 1/3 (33%)
Ig strand F 109..114 CDD:409382 2/4 (50%)
Ig strand G 122..125 CDD:409382 1/2 (50%)
Ig_3 134..199 CDD:464046 23/72 (32%)
Ig_3 217..295 CDD:464046 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.