DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and zig-3

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:319 Identity:58/319 - (18%)
Similarity:108/319 - (33%) Gaps:108/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGIAILTAGS 130
            |.||.....:.:..:.||.....|...|.....|||::.|.|:|.:|.|.|:.|::       ..
 Worm    24 AAVSNLVREIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYWEK-------DG 81

  Fly   131 VKVTPDPRV----RLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHI---- 187
            .::..|..:    :::|.....:...:.|.:....|                   ..:|||    
 Worm    82 QRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPC-------------------ANLHHIGSYK 127

  Fly   188 --STGGHLQVKKGSSVRIE-----CSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHK 245
              :|.||..|:..:.:.:|     |.:|....|.:|.|.::.                       
 Worm   128 CVATNGHDTVESSAKISVEGQTVKCKSTRRSAPVITMSTESR----------------------- 169

  Fly   246 GGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDT 310
                                                 |..:.:.|||:|  ..:.:....|..:.
 Worm   170 -------------------------------------FELQDNAATLIC--RADRRANWNWMFED 195

  Fly   311 MQLD-TTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKAR-KTLQLSGKPNVA 367
            .::| .:.|:.:...|.   |:|||:...|.|:|.|:|.|:.|::| :|.....|.::|
 Worm   196 KKIDFDSGRYELLPSGD---LLIRKIQWSDMGSYFCIAHNKYGESRGETFLYPTKKHIA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 13/83 (16%)
Ig 103..177 CDD:143165 11/77 (14%)
IG_like 191..269 CDD:214653 9/82 (11%)
IGc2 198..258 CDD:197706 6/64 (9%)
I-set 273..360 CDD:254352 22/88 (25%)
Ig 290..359 CDD:143165 21/70 (30%)
FN3 <466..524 CDD:238020
zig-3NP_509336.1 I-set 45..145 CDD:254352 23/125 (18%)
Ig 61..142 CDD:143165 18/106 (17%)
IG_like 177..244 CDD:214653 21/71 (30%)
Ig <191..237 CDD:299845 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.