DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and zig-2

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:213 Identity:50/213 - (23%)
Similarity:73/213 - (34%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRK-------------NNILPNGEEKLHS 233
            |.:....|.....|..|....:.|.|.|.|:|::.|...             .|||.:|::..::
 Worm    31 PLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNA 95

  Fly   234 HVLS----IENVDRHKGGVYICTANNRV-----------------------GQPASSQVVLHVLF 271
            .::|    |........|.|.|..:|.:                       |.|..|   :.|.|
 Worm    96 AMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFIS---MTVDF 157

  Fly   272 SPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFK-DTMQLDTTERHIMETRGSRHTLIIRKV 335
            ..|||          .:...|.|  ..||..|..|.| :.:..:..||:.|...|.   ||||.:
 Worm   158 RLEIS----------NNAVALSC--RSETATEWSWHKGEQLLTNDGERYQMFPSGD---LIIRNI 207

  Fly   336 HPQDFGNYSCVAENQLGK 353
            ...|.|.|:|.|.|..|:
 Worm   208 SWSDMGEYNCTARNHFGE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653
Ig 103..177 CDD:143165
IG_like 191..269 CDD:214653 21/117 (18%)
IGc2 198..258 CDD:197706 17/99 (17%)
I-set 273..360 CDD:254352 25/82 (30%)
Ig 290..359 CDD:143165 22/65 (34%)
FN3 <466..524 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 19/99 (19%)
Ig 34..121 CDD:299845 18/86 (21%)
Ig <179..232 CDD:299845 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.