DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and rig-4

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 / 177597 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans


Alignment Length:488 Identity:98/488 - (20%)
Similarity:172/488 - (35%) Gaps:166/488 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLPTRSSSSSSRIAYKFECHSNSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPHILFLAIAVVS 69
            :|...:.||.:|..:|.||.:::.....:.:.:|....||:|                       
 Worm   283 RLIISNPSSFTRGEHKLECRADAAMGRTSDQKSAYMTFISRP----------------------- 324

  Fly    70 LHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGIAILTAGSVKVT 134
                       :.|:.|..|.::      .|.::.|.|.|....:..:.|.:...::|....|:|
 Worm   325 -----------ILKDLPNEIQKT------VGSSLSLKCSVKKKSSMDIKWYKNGLMMTTQRGKLT 372

  Fly   135 PDPRVRLVNGFNLQIRDALPTDAGDYICQ------------------------------------ 163
            .| |::             ..|.|.|.|:                                    
 Worm   373 ID-RIK-------------QDDFGLYQCEATNAAGADLASVWVKEGEANETVATEMSEDGMSLEE 423

  Fly   164 ---IATMDPREI-----THTVEILVP------PRIHHISTGGHLQVKKGSS-VRIECSATGNPMP 213
               :.|..||::     :.:.|.|.|      |....|.|...|.|..|:. :.:||:|||:|.|
 Worm   424 EISMETPPPRKLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGTDRIMMECAATGSPPP 488

  Fly   214 NVTWSRKNNILPNGEE--------KLHSHVLSIENVDRHKGGVYIC---------TANNRVG--- 258
            |:.|      |.||.|        .|.:..|:|.::.:...|.|.|         |||.:|.   
 Worm   489 NIIW------LLNGHEIQTDNVKYDLTNDGLAIHDIRKSDEGEYTCEISGSNVKATANVQVNGDS 547

  Fly   259 ----QPASSQVVL--HVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTE 317
                .||..:.::  :|.||.|::.|.....|.|.:...::..|:|.:...:             
 Worm   548 LIEYGPADQKSLIGTNVEFSCEVAKEYVRKASVEWYLNDVLLPVNGNSGLRI------------- 599

  Fly   318 RHIMETRGSRHTLIIRKVHPQDFGNYSC--VAENQLGKARKTLQLSGKP------NVAVFNSPPI 374
                 :|..:.:||||:|.|.:.|.|.|  ..:.:...|...||:..||      ...:.|....
 Worm   600 -----SRNRKGSLIIRQVGPDNTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMP 659

  Fly   375 SQYKDRYNISWAVDSHSPIEEYKLSFRKL-PQG 406
            ::.:.|:|..:  |.:.||.::.:..|.: |.|
 Worm   660 AKVRVRWNEGF--DGNEPIIKHAIEMRTMGPTG 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 18/123 (15%)
Ig 103..177 CDD:143165 16/117 (14%)
IG_like 191..269 CDD:214653 28/104 (27%)
IGc2 198..258 CDD:197706 23/77 (30%)
I-set 273..360 CDD:254352 18/88 (20%)
Ig 290..359 CDD:143165 13/70 (19%)
FN3 <466..524 CDD:238020
rig-4NP_501339.2 IG_like 330..402 CDD:214653 16/91 (18%)
IGc2 338..393 CDD:197706 14/68 (21%)
I-set 459..543 CDD:254352 27/89 (30%)
IGc2 478..534 CDD:197706 19/61 (31%)
IG_like 553..639 CDD:214653 23/103 (22%)
Ig 564..635 CDD:143165 20/88 (23%)
FN3 643..747 CDD:238020 10/50 (20%)
FN3 756..850 CDD:238020
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.