DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and zig-8

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:340 Identity:72/340 - (21%)
Similarity:119/340 - (35%) Gaps:112/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGET-IVLPCEVANTDTY 115
            ||..::..||| :....:.|..|....:.:.:......:.|:|...:..|. ..|.|.|.....:
 Worm     2 RRFSNICVILF-SFLYATGHGASEEVMACLRQERSRVENPSQTIVNVVAENPAYLHCSVPPDAEH 65

  Fly   116 VVAWKR---GIAILTAGSVKVTPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATMDPREIT 173
            .:||.|   | |:||||:...|.|||.::    .|.:.|.:|.|...|:|.|:|:|  .|.....
 Worm    66 EIAWTRVSDG-ALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLCEI--NDKHNTV 127

  Fly   174 HTV--EILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVL 236
            :.|  ::|.||.                           |.|:....:...::.|          
 Worm   128 YAVYLKVLEPPL---------------------------PSPSSLQKKSTKLMAN---------- 155

  Fly   237 SIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQ 301
                                                          .||:  |..|.|.|....:
 Worm   156 ----------------------------------------------MSGD--EVVLNCTVTSTDK 172

  Fly   302 PE----VIWFKD--TMQLDTTERHIMETRGSR----HTLIIRKVHPQDFGNYSCVAENQLGKARK 356
            .|    |:|.:|  |:..:.||::|::.:...    .|:.|||...:|.|||:|  |:...||.:
 Worm   173 DEEVLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIETMRIRKATMEDDGNYAC--EHSQQKASQ 235

  Fly   357 TLQLSGKPNVAVFNS 371
            .:.:: |......||
 Worm   236 IVHIN-KAEAQTSNS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/89 (31%)
Ig 103..177 CDD:143165 27/82 (33%)
IG_like 191..269 CDD:214653 3/77 (4%)
IGc2 198..258 CDD:197706 3/59 (5%)
I-set 273..360 CDD:254352 26/96 (27%)
Ig 290..359 CDD:143165 23/78 (29%)
FN3 <466..524 CDD:238020
zig-8NP_499714.1 IG_like 55..134 CDD:214653 27/81 (33%)
Ig 55..129 CDD:143165 26/76 (34%)
ig 158..229 CDD:278476 23/74 (31%)
IG_like 158..227 CDD:214653 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.