DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and CEACAM20

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_011524731.1 Gene:CEACAM20 / 125931 HGNCID:24879 Length:623 Species:Homo sapiens


Alignment Length:449 Identity:102/449 - (22%)
Similarity:163/449 - (36%) Gaps:107/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATG 209
            :..:.||||.:...|.|    .:|.:.....|||.:.   ..:::|..::|.:|||:........
Human   163 YQCEARDALLSQRSDPI----FLDVKYGPDPVEIKLE---SGVASGEVVEVMEGSSMTFLAETKS 220

  Fly   210 NPMPNVTWSRKNNILPNGEEKLHSH---VLSIENVDRHKGGVYICTANNRVGQPASSQV----VL 267
            :|....||...::||        ||   ..:|..|.|...|:|.|..:|.....:|...    ||
Human   221 HPPCAYTWFLLDSIL--------SHTTRTFTIHAVSREHEGLYRCLVSNSATHLSSLGTLKVRVL 277

  Fly   268 HVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSRHTLII 332
            ..|..|:: |...:..........|.|....:: ..|.||.....|..:| |:..:..:| ||||
Human   278 ETLTMPQV-VPSSLNLVENARSVDLTCQTVNQS-VNVQWFLSGQPLLPSE-HLQLSADNR-TLII 338

  Fly   333 RKVHPQDFGNYSCVAENQLGKAR-KTLQLS---GKPNVAVFN---SPPISQYKDRYNIS-----W 385
            ..:...|.|.|:|...|...:|| :.|:|:   |...|.:..   |..||..:...|.|     |
Human   339 HGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVHITRESASEMISTIEAELNSSLTLQCW 403

  Fly   386 AVDSHSPIEEYK--------------LSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQM------ 430
            |  ...|..||:              |..|.|...|:.:.|. .:|:|.:.::.|:|.:      
Human   404 A--ESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNC-TASNSLTGLARSTSVLVKVVGP 465

  Fly   431 YGSGLHAHRIGSNMGGLSGLSGSGSYSGYGNVIHWGHNDWRNVVLPA--------------VPVS 481
            ..|.|.:..|...:.|:..:....|..||...|       ||...|:              :|..
Human   466 QSSSLSSGAIAGIVIGILAVIAVASELGYFLCI-------RNARRPSRKTTEDPSHETSQPIPKE 523

  Fly   482 HH----YAQGMSYMVRGLD----------------PDQHYEATVQSRNRYGWSDLTNSF 520
            .|    .::.:|...|.:.                |::.||..:.|.:|.|     |||
Human   524 EHPTEPSSESLSPEYRNISQLQGRIRVELMQPPDLPEETYETKLPSASRRG-----NSF 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 10/34 (29%)
Ig strand B 103..107 CDD:409353
Ig strand C 116..120 CDD:409353
Ig strand E 145..149 CDD:409353 0/3 (0%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 22/93 (24%)
Ig strand B 201..205 CDD:409353 0/3 (0%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 19/75 (25%)
FN3 <466..524 CDD:238020 16/89 (18%)
CEACAM20XP_011524731.1 Ig 96..183 CDD:472250 6/23 (26%)
Ig strand B 113..117 CDD:409353
Ig strand C 126..130 CDD:409353
Ig strand E 148..152 CDD:409353
Ig strand F 162..167 CDD:409353 0/3 (0%)
Ig strand G 177..180 CDD:409353 2/6 (33%)
IG_like 202..274 CDD:214653 19/79 (24%)
Ig strand C 226..229 CDD:409353 1/2 (50%)
Ig strand E 241..244 CDD:409353 0/2 (0%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig 283..370 CDD:472250 24/90 (27%)
Ig strand B 299..303 CDD:409353 1/3 (33%)
Ig strand C 312..316 CDD:409353 2/3 (67%)
Ig strand E 334..338 CDD:409353 3/4 (75%)
Ig strand F 348..353 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig 396..462 CDD:472250 15/68 (22%)
Ig strand B 398..402 CDD:409353 0/3 (0%)
Ig strand C 411..415 CDD:409353 2/3 (67%)
Ig strand E 429..433 CDD:409353 1/3 (33%)
Ig strand F 440..445 CDD:409353 1/5 (20%)
Ig strand G 455..458 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.