DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Fgfrl1

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:470 Identity:95/470 - (20%)
Similarity:171/470 - (36%) Gaps:100/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAW-KR 121
            |.:|.|.:..:.....:.....|..|..|..::|       .|.|:.|.|.|......:..| |.
Mouse     5 PALLLLLLGALPSAEAARGPPRMADKVVPRQVAR-------LGRTVRLQCPVEGDPPPLTMWTKD 62

  Fly   122 GIAILTAGS-VKVTPDPRVRLVNGFNLQIRDALPTDAGDYICQIAT-MDPREITHTVEIL--VPP 182
            |..|.:..| .:|.|.         .|::::....|||.|:|:... .....:.:|:.|:  :.|
Mouse    63 GRTIHSGWSRFRVLPQ---------GLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISP 118

  Fly   183 RIHHISTGG-----------------HLQVKK----------GSSVRIECSATGNPMPNVTWSRK 220
            .......||                 ..|..|          |||||::|.|:|:|.|::.|.:.
Mouse   119 GKESPGPGGSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKD 183

  Fly   221 NNILPNGEEKLH---SHVLSIENVDRHKGGVYICTANNRVGQPASS---QVVLHVLFSPEISVER 279
            :..|.:.|...|   ...||::|:.....|.|.|..:|:.|...::   .|:......|.::...
Mouse   184 DQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTH 248

  Fly   280 PVVFSGE-GHEATLVCIVHGETQPEVIWFKDTMQLDTTERH--IMETRGSR-------------- 327
            ||..:.: |...:..|.|..:.:|.:.|.| .::..:..||  .::..|.:              
Mouse   249 PVNTTVDFGGTTSFQCKVRSDVKPVIQWLK-RVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPD 312

  Fly   328 ----HTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVD 388
                :.|:|.:....|.|.|.|:..|.:|.:.::..|:..|:... ..||::......::.|.|.
Mouse   313 GSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKP-PGPPMASSSSSTSLPWPVV 376

  Fly   389 SHSP---------IEEYKLSFRKLP---------QGHEVVGNAIDSSSSSS--SMSSSSSQMYGS 433
            ...|         :..:....:|.|         .||...|.:.:.|....  |::....:.:||
Mouse   377 IGIPAGAVFILGTVLLWLCQTKKKPCAPASTLPVPGHRPPGTSRERSGDKDLPSLAVGICEEHGS 441

  Fly   434 GL---HAHRIGSNMG 445
            .:   |....||..|
Mouse   442 AMAPQHILASGSTAG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/84 (24%)
Ig 103..177 CDD:143165 17/76 (22%)
IG_like 191..269 CDD:214653 26/110 (24%)
IGc2 198..258 CDD:197706 21/62 (34%)
I-set 273..360 CDD:254352 20/107 (19%)
Ig 290..359 CDD:143165 16/88 (18%)
FN3 <466..524 CDD:238020
Fgfrl1NP_473412.1 I-set 29..112 CDD:369462 22/98 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 4/34 (12%)
Ig2_FGFRL1-like 153..234 CDD:143264 22/80 (28%)
Ig 257..351 CDD:386229 18/94 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.