DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and si:dkey-11p23.7

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001095865.1 Gene:si:dkey-11p23.7 / 100006927 ZFINID:ZDB-GENE-100922-120 Length:287 Species:Danio rerio


Alignment Length:213 Identity:52/213 - (24%)
Similarity:86/213 - (40%) Gaps:43/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ITGETIVLPCEV-----ANTDTYVVAWKRG-----IAILTAGSV--------KVTPDPRVRLV-- 142
            |.|..:||||..     .:..:..|:|..|     :.:....|:        |...|.|.||.  
Zfish    39 IEGYPVVLPCSFTHPHHTHPSSMYVSWTLGHGRAAVLLFRCSSLNNSQLCQSKPNQDQRYRLEGN 103

  Fly   143 ---NGFNLQIRDALPTDAGDYICQIA------TMDPREITHTVEILVPPRIHHISTGGHLQVKKG 198
               :..:|::......|:|.|.|::.      |.....:...:.:...|||..:|..|    .:.
Zfish   104 HRNHDISLRVNSLTLKDSGRYYCRVELPGHQHTSFENTLGTRLRVEAAPRILSLSAEG----SEI 164

  Fly   199 SSVRIECSATGNPMPNVTWSRKNNIL------PNGEEKLHSHVLSIENVDRHKGGVYICTANNRV 257
            |..:..|...|:|:|:|.|...|.:|      |..::....:..|.:.:|...||.|||.|:|.:
Zfish   165 SGFKAVCEVQGSPLPDVQWIAPNGVLDGDAAFPLSQDTAGQYRASSQLLDVQPGGQYICAASNSL 229

  Fly   258 GQPASSQVVLHVLF-SPE 274
            |:   .|..|::|. |||
Zfish   230 GK---DQATLYLLCPSPE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/108 (19%)
Ig 103..177 CDD:143165 19/102 (19%)
IG_like 191..269 CDD:214653 23/83 (28%)
IGc2 198..258 CDD:197706 19/65 (29%)
I-set 273..360 CDD:254352 2/2 (100%)
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
si:dkey-11p23.7NP_001095865.1 IG_like 33..148 CDD:214653 21/108 (19%)
V-set 33..148 CDD:284989 21/108 (19%)
Ig 150..238 CDD:299845 27/94 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.