DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13051 and CG13678

DIOPT Version :10

Sequence 1:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_648193.1 Gene:CG13678 / 38922 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster


Alignment Length:108 Identity:55/108 - (50%)
Similarity:61/108 - (56%) Gaps:32/108 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVAAVIFALFACVAAKPGIV-----APLAYSAPYV--ASPYVASPYVASPYV---------- 48
            |||| ||:.||:.|..||||||:     |||||:||.|  ::.||| || ||.|.          
  Fly     1 MFKF-AAIFFAVVAVAAAKPGILAPLAAAPLAYTAPAVVGSAAYVA-PY-ASSYTAHSVAHSAAF 62

  Fly    49 ----AAPYTAAYTAAYAAPYTTAYTAPY--------AAYTSPL 79
                |||..|||||..|||...||||||        |||||||
  Fly    63 PASYAAPVAAAYTAPIAAPLAAAYTAPYTRFATPYAAAYTSPL 105

Return to query results.
Submit another query.