DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13051 and CG13674

DIOPT Version :9

Sequence 1:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001261570.1 Gene:CG13674 / 38921 FlyBaseID:FBgn0035858 Length:137 Species:Drosophila melanogaster


Alignment Length:86 Identity:50/86 - (58%)
Similarity:58/86 - (67%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVAAVIFALFACVAAKPGIVAPLAYSAPYV--ASPYVASPYVASPYVA------APYTAAYTAA 59
            ||:|...||:.|..||||||||||||:||.|  ::.||| || ||.|.|      |.:.||||||
  Fly     2 KFLAVCFFAVVAVAAAKPGIVAPLAYTAPAVVGSAAYVA-PY-ASSYTANSVAHSAAFPAAYTAA 64

  Fly    60 YAAPYTTAYTAPY-AAYTSPL 79
            |.||...|||||. ||||:|:
  Fly    65 YTAPVAAAYTAPVAAAYTAPV 85



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.