DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13051 and CG32266

DIOPT Version :10

Sequence 1:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_728900.1 Gene:CG32266 / 317945 FlyBaseID:FBgn0052266 Length:77 Species:Drosophila melanogaster


Alignment Length:34 Identity:8/34 - (23%)
Similarity:21/34 - (61%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IDPTNHRLHHHTNYISRRHLHSSHKEHETKIISD 122
            ||....||.:.:|..|.:::.|:.::::..:::|
  Fly   471 IDSERTRLGNESNSQSAKYVLSTREDYKAPLVAD 504

Return to query results.
Submit another query.