DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and SLC5A1

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_000334.1 Gene:SLC5A1 / 6523 HGNCID:11036 Length:664 Species:Homo sapiens


Alignment Length:54 Identity:13/54 - (24%)
Similarity:23/54 - (42%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGATTGF 57
            :||:.||:|.:..:.....|....|.|       :::..|..|::     .|||
Human   180 AIFLLLAITALYTITGGLAAVIYTDTL-------QTVIMLVGSLI-----LTGF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
SLC5A1NP_000334.1 SLC5sbd_SGLT1 27..664 CDD:271379 13/54 (24%)

Return to query results.
Submit another query.