DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and Slc5a2

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_072112.2 Gene:Slc5a2 / 64522 RGDID:620217 Length:670 Species:Rattus norvegicus


Alignment Length:51 Identity:10/51 - (19%)
Similarity:25/51 - (49%) Gaps:15/51 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIK-ELTSSILAMSGAT 54
            ::||..::..:|.|            |.|  :::::. .:.:|::|:.|.|
  Rat   147 LYIFTKISVDMFSG------------AVF--IQQALGWNIYASVIALLGIT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
Slc5a2NP_072112.2 SLC5-6-like_sbd 22..670 CDD:444915 10/51 (20%)

Return to query results.
Submit another query.