DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and Slc5a4a

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_573447.2 Gene:Slc5a4a / 64452 MGIID:1927848 Length:656 Species:Mus musculus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:14/30 - (46%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYSIF-IFLALTCVL-FMGQSCLAAPSAD 28
            :.|..| |.|...|:| .:|.|.|..|..|
Mouse   524 VHYLYFAIILFFVCILVILGVSYLTKPIPD 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
Slc5a4aNP_573447.2 SLC5-6-like_sbd 27..656 CDD:444915 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.