DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and CG7720

DIOPT Version :9

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_001163649.1 Gene:CG7720 / 42257 FlyBaseID:FBgn0038652 Length:681 Species:Drosophila melanogaster


Alignment Length:89 Identity:21/89 - (23%)
Similarity:30/89 - (33%) Gaps:43/89 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLALTCVLFMGQSCLAAPSADDLA------------KFGEME-----RSIKELT---------- 44
            ||:|   .||.|..|:...:.:.||            ||..:.     |.:|.:|          
  Fly   339 IFMA---TLFNGALCMMVSNLNSLATVIWEDFISQLPKFKGLSDKQQLRILKSITVVCGLIIMGV 400

  Fly    45 ------------SSILAMSGATTG 56
                        ||:|..| ||:|
  Fly   401 AFGVGLLAGVIESSLLVFS-ATSG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
CG7720NP_001163649.1 SLC5sbd_NIS-SMVT 10..556 CDD:271383 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.