DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and ChT

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_650743.1 Gene:ChT / 42245 FlyBaseID:FBgn0038641 Length:614 Species:Drosophila melanogaster


Alignment Length:45 Identity:13/45 - (28%)
Similarity:21/45 - (46%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLALTC-VLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM 50
            :||...| .:|.....|||..| .|:...:|:.....:.||.:|:
  Fly   124 LFLPALCGEVFWAAGILAALGA-TLSVIIDMDHRTSVILSSCIAI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
ChTNP_650743.1 SLC5sbd_CHT 7..481 CDD:271368 13/45 (29%)

Return to query results.
Submit another query.