DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and CG10444

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_611465.2 Gene:CG10444 / 37294 FlyBaseID:FBgn0034494 Length:587 Species:Drosophila melanogaster


Alignment Length:38 Identity:10/38 - (26%)
Similarity:17/38 - (44%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGAT 54
            |||    .|....|...|....|:..::|::.::|..|
  Fly   327 MGQ----YPGLCGLFVSGIFSASLSTISSAVTSLSAVT 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
CG10444NP_611465.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 10/38 (26%)

Return to query results.
Submit another query.