DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and Slc5a12

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_001102058.1 Gene:Slc5a12 / 362188 RGDID:1311652 Length:619 Species:Rattus norvegicus


Alignment Length:92 Identity:17/92 - (18%)
Similarity:32/92 - (34%) Gaps:36/92 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLALTCVLFMG-------QSC-------LAAPSADDLAKFGEME------------------RS 39
            :::.:.|.:|.|       :.|       :.||  |.|..:..||                  .:
  Rat   283 LWIIVVCAVFCGLIMYAYYKDCDPWTSGAILAP--DQLMPYFVMEIFATMPGLPGLFVACAFSGT 345

  Fly    40 IKELTSSILAMSGATTGFRPGANNVWP 66
            :..:.:||.|:  ||..|.....:.:|
  Rat   346 LSTVAASINAL--ATVTFEDFVKSCFP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
Slc5a12NP_001102058.1 SLC5sbd_SMCT2 3..527 CDD:212089 17/92 (18%)

Return to query results.
Submit another query.