powered by:
Protein Alignment CG34337 and CG31668
DIOPT Version :9
Sequence 1: | NP_001096901.1 |
Gene: | CG34337 / 5740569 |
FlyBaseID: | FBgn0085366 |
Length: | 71 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097055.2 |
Gene: | CG31668 / 33395 |
FlyBaseID: | FBgn0051668 |
Length: | 590 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 22/47 - (46%) |
Gaps: | 2/47 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 YSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILA 49
|.|..|:.:.||::.....|.|....|:.:...|..|: ||..:||
Fly 181 YLIEAFIIVICVIYTVLGGLKAVVHTDIWQVVIMFASV--LTIVVLA 225
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34337 | NP_001096901.1 |
None |
CG31668 | NP_001097055.2 |
SLC5sbd_NIS-SMVT |
9..531 |
CDD:271383 |
14/47 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0591 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.