DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and Slc5a1

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_037165.1 Gene:Slc5a1 / 25552 RGDID:3713 Length:665 Species:Rattus norvegicus


Alignment Length:54 Identity:15/54 - (27%)
Similarity:21/54 - (38%) Gaps:12/54 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGATTGF 57
            :|||.||:|.:..:.....|....|.|.            |:.:|..|...|||
  Rat   180 AIFILLAITALYTITGGLAAVIYTDTLQ------------TAIMLVGSFILTGF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
Slc5a1NP_037165.1 SLC5-6-like_sbd 27..665 CDD:444915 15/54 (28%)

Return to query results.
Submit another query.