powered by:
Protein Alignment CG34337 and Slc5a1
DIOPT Version :9
Sequence 1: | NP_001096901.1 |
Gene: | CG34337 / 5740569 |
FlyBaseID: | FBgn0085366 |
Length: | 71 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_037165.1 |
Gene: | Slc5a1 / 25552 |
RGDID: | 3713 |
Length: | 665 |
Species: | Rattus norvegicus |
Alignment Length: | 54 |
Identity: | 15/54 - (27%) |
Similarity: | 21/54 - (38%) |
Gaps: | 12/54 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 SIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGATTGF 57
:|||.||:|.:..:.....|....|.|. |:.:|..|...|||
Rat 180 AIFILLAITALYTITGGLAAVIYTDTLQ------------TAIMLVGSFILTGF 221
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34337 | NP_001096901.1 |
None |
Slc5a1 | NP_037165.1 |
SLC5-6-like_sbd |
27..665 |
CDD:382020 |
15/54 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.