powered by:
Protein Alignment CG34337 and F52H2.4
DIOPT Version :9
Sequence 1: | NP_001096901.1 |
Gene: | CG34337 / 5740569 |
FlyBaseID: | FBgn0085366 |
Length: | 71 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001360058.1 |
Gene: | F52H2.4 / 186132 |
WormBaseID: | WBGene00018716 |
Length: | 491 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 14/63 - (22%) |
Similarity: | 26/63 - (41%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FIFLALTCV--LFMGQSCLAAPSADDLAKFGEMERSIKELTSSIL-----AMSGATTGFRPGA 61
|:..:|.|| :......|.|||. .:|....:..::..|.:::| ::.|...|....|
Worm 46 FVTTSLFCVQMILYNSVALYAPSL-AIASITNIPITVSILITAVLSAFYISVGGVKAGIHTSA 107
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34337 | NP_001096901.1 |
None |
F52H2.4 | NP_001360058.1 |
SLC5-6-like_sbd |
1..447 |
CDD:382020 |
14/63 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.