DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and bumpel

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:XP_321571.6 Gene:bumpel / 1281626 VectorBaseID:AGAMI1_010700 Length:595 Species:Anopheles gambiae


Alignment Length:53 Identity:14/53 - (26%)
Similarity:23/53 - (43%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGAT 54
            :|.:|:.:.:.|:| :|            ..||.::|  |..|.|...|.|.|
Mosquito    19 DYLVFVSMLMLCIL-IG------------VYFGFVQR--KPNTESEYLMGGRT 56

Return to query results.
Submit another query.