DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and LOC1278121

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:XP_317660.5 Gene:LOC1278121 / 1278121 VectorBaseID:AGAMI1_012337 Length:646 Species:Anopheles gambiae


Alignment Length:56 Identity:12/56 - (21%)
Similarity:29/56 - (51%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSGATTG 56
            ::.:||:   ..||:.:|.:.|..     |....::: .|..:::::.|::..|||
Mosquito   424 LKANIFV---RCCVVILGLTALGC-----LFIIDKLD-GILIVSATLAAIANGTTG 470

Return to query results.
Submit another query.