DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and LOC1273345

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:XP_312311.5 Gene:LOC1273345 / 1273345 VectorBaseID:AGAMI1_015159 Length:607 Species:Anopheles gambiae


Alignment Length:49 Identity:15/49 - (30%)
Similarity:21/49 - (42%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MGQSCLAA--PSADDLAKFGEMERSIKELTSSILAMSGATTGFRPGANN 63
            ||..||..  |.|:   |.|.:..|    .||::.||....|.:...:|
Mosquito   430 MGIFCLGMLWPWAN---KHGALWGS----ASSVIVMSWIIAGAQIAISN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
LOC1273345XP_312311.5 SLC5sbd_NIS-SMVT 17..538 CDD:271383 15/49 (31%)

Return to query results.
Submit another query.