DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and SLC5A10

DIOPT Version :10

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:XP_016879680.2 Gene:SLC5A10 / 125206 HGNCID:23155 Length:649 Species:Homo sapiens


Alignment Length:82 Identity:16/82 - (19%)
Similarity:27/82 - (32%) Gaps:25/82 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TCVLFMGQSCLAAPSADDLAKFGEME---------RSIKELTSSI----------------LAMS 51
            |.::.:|...|...:.|.:..:|::|         |:|...|..:                |..:
Human   200 TLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWT 264

  Fly    52 GATTGFRPGANNVWPED 68
            |.|.|....|...|..|
Human   265 GMTFGLTIMATWYWCTD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
SLC5A10XP_016879680.2 SLC5-6-like_sbd 17..649 CDD:444915 16/82 (20%)

Return to query results.
Submit another query.