DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34337 and slc5a10

DIOPT Version :9

Sequence 1:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster
Sequence 2:XP_017211446.2 Gene:slc5a10 / 100007379 ZFINID:ZDB-GENE-110922-5 Length:637 Species:Danio rerio


Alignment Length:97 Identity:23/97 - (23%)
Similarity:36/97 - (37%) Gaps:26/97 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYSIF--IFLALTCVLFMGQSCLAAPSADD---------LAKFGEMERSIKELTSSILAMSGA- 53
            |.|..|  |..|||.::....|.|..|..::         |....|.|..::::::......|. 
Zfish   511 MHYLHFAIILCALTAIVVAVISLLTPPPTEEQTRNLTWWTLHNSTEREIPLQKVSTLSRRTDGCE 575

  Fly    54 ---------TTGF---RPG--ANNVWPEDLHA 71
                     |.||   |||  |:...|..:|:
Zfish   576 SVRRGKCVRTAGFCSPRPGRFASGTPPPIIHS 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34337NP_001096901.1 None
slc5a10XP_017211446.2 SLC5sbd_SGLT5 17..637 CDD:212058 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.