DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34370 and CG7631

DIOPT Version :9

Sequence 1:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:238 Identity:52/238 - (21%)
Similarity:80/238 - (33%) Gaps:75/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 WLAVYDGRDEHSPLIGKFC-GLGKFPFSIIG-------TSQY----MYVEFVTSPAGPLLNTGFH 361
            |..::        |:|..| |:...||:...       |:.|    |.|::..:  |.|..|   
  Fly     5 WFQLF--------LLGTLCSGIFPAPFNTHYDETDPELTAGYFQGDMDVDYARN--GQLSET--- 56

  Fly   362 FNVGNWPG--------------HVETAGIKHGVCDWLLSSDSLK----DSSASEGIFLSIAHWYP 408
               ..||.              |||.  ||.|: .::..|..::    |......:|:     .|
  Fly    57 ---RRWPNATVPYRISEEFDAPHVEY--IKLGM-QFIEYSSCIRFVPADEDEENYLFV-----LP 110

  Fly   409 PNTSCSYHIKGHVGE-IVRLYFPS-----FRINRIESPILKYEGDCGESLTIYDSDHADPAR--I 465
            ..:.||..:....|| .|:|...|     |::..|:..:|...|        :......|.|  .
  Fly   111 STSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLG--------FHHQQCSPNRDEF 167

  Fly   466 IKTFCDTFSRPMEKVDFVSTSPSLYVQFDSKTGSYS-GSSLYY 507
            :|...:..|...|| :||.........||.   .|. ||.|:|
  Fly   168 VKIVEENISEGHEK-NFVKYEEDEVGDFDQ---PYDYGSILHY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34370NP_001097404.2 CUB 88..195 CDD:238001
CUB 244..363 CDD:238001 14/65 (22%)
CUB 407..509 CDD:238001 27/110 (25%)
CG7631NP_609760.1 Astacin 57..251 CDD:279708 38/170 (22%)
ZnMc_astacin_like 61..248 CDD:239807 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.