DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34370 and nas-29

DIOPT Version :9

Sequence 1:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:429 Identity:77/429 - (17%)
Similarity:118/429 - (27%) Gaps:172/429 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QIVDGNAKTDVS---NRREPGMFCGEAEQPQTFISETSYVKVLFHTDNFTD--QTYFTFDSRAEQ 203
            |..|.:...|||   |..|..:..|:..:        .|..:||..|....  |.....:...|.
 Worm    55 QYSDSHLSFDVSTIYNYSEKPISIGKLNK--------KYRDILFEGDMAISYKQLSMIVNGSTEY 111

  Fly   204 QTEVYLRYGQHPELYPNRRGEVVQGSYCEREYRDCRLQTCYVQSPA-----------YPGLYP-- 255
            :..:..|          |||..:.|...:|..|...|...|   ||           :..|.|  
 Worm   112 RKAIKSR----------RRGNKINGESTDRTKRQAYLDNNY---PATIWKNGVAFMFHESLTPIA 163

  Fly   256 -----RALNCRYK-----LHTR--QPYIKLYLQNEQ-----FAVDGQRCENVMTCPIRPIGSGNE 303
                 :|::..|:     .|.|  |....|::.|:.     ...|..:.:.|::     ||:|.|
 Worm   164 KTAILKAVHFWYRETCIEFHPRTFQKEYLLFIGNDDGCWSTVGRDASQGKQVVS-----IGNGCE 223

  Fly   304 H--------------------CPYDWLAVYDGRDEHSPLIGKFCGLGK-------FPFSIIGTSQ 341
            |                    ...|...|::.|.....|:..|..:..       .|:.|.....
 Worm   224 HFGVTSHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMH 288

  Fly   342 YMYVEFVTSPAGPLL---NTGFHFNVGNWPG------HVET------------------------ 373
            |...||...|:.|.|   :|.....:|...|      |:..                        
 Worm   289 YTPTEFSNIPSIPTLAAIDTNLQQTMGQLEGPSFVDVHIMNQHYQCQEKCPTQAPCQNGGFTNSR 353

  Fly   374 --------AGIKHGVCDWLLSSDS-------------------LKDSSASEGIFLSIAHWYPPNT 411
                    .|.....|..:.||.|                   ::.|:.:.            :.
 Worm   354 NCKVCKCPTGFGGAYCQLIASSFSPFCGGYLNAEETTRRFDITIRQSTTTR------------SK 406

  Fly   412 SCSYHIKGHVGEIVRLYFPSFRINRIESPILKYEGDCGE 450
            :|.||||...|:            ||...|||.:..|.|
 Worm   407 TCVYHIKAPEGK------------RIIIDILKIDSKCIE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34370NP_001097404.2 CUB 88..195 CDD:238001 13/55 (24%)
CUB 244..363 CDD:238001 33/178 (19%)
CUB 407..509 CDD:238001 13/44 (30%)
nas-29NP_494953.3 Astacin 145..336 CDD:279708 33/195 (17%)
ZnMc_astacin_like 148..332 CDD:239807 33/188 (18%)
CUB 404..491 CDD:214483 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.