DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:378 Identity:107/378 - (28%)
Similarity:159/378 - (42%) Gaps:81/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLLTIVSG--FCKG-------ENHTRG----------WLPEFCVVGEQKCPNSRVSFWLYTNQ- 52
            :|||..|.|  .|.|       |....|          |.||          :....|.||||: 
Human     9 LLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPE----------DIDTRFLLYTNEN 63

  Fly    53 -------TRDDPIQLDPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISV 110
                   |..:|..::..|     ||.....:.:||||:.....:...::...:.:.:.:|.|.|
Human    64 PNNFQLITGTEPDTIEASN-----FQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICV 123

  Fly   111 DYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQ 175
            |:....|  ..|..||.|..:|....|.:|..|.:......||:|:||.||||..|......:..
Human   124 DWRHGSR--AMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGG 186

  Fly   176 PLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTD--PFF----FSMLPPMGHADFYPNLD 234
            .:.||||||||||.|..:|. :.:||.|||.|||:||||  |..    |.|...:||.||:||..
Human   187 RVGRITGLDPAGPCFQDEPE-EVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGG 250

  Fly   235 QLNQRGC-----SYISN----WR----FYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQR 286
            : ...||     |.|::    |.    |.:|||.|:..||..|:::..||....|..:.:|...:
Human   251 K-EMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESK 314

  Fly   287 C-----------SHYSNM-----PNTQMGYFVSEDASGSYFLTTHEVAPFAKG 323
            |           .||::.     ...:..:|::...||::....::|:....|
Human   315 CFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 93/314 (30%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 100/354 (28%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 4/11 (36%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 4/21 (19%)
PLAT_PL 357..469 CDD:238857 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.