DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and lipia

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:304 Identity:87/304 - (28%)
Similarity:133/304 - (43%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVSFWLYTNQTRDDPIQLDPLNPQK----DVFQPRLPLKILIHGFIGNRNLTPNLEVR---DVLL 100
            :|...||   ||.||.....|:.|:    ..|........||||:  ....:|.:.::   :.||
Zfish    44 KVRLLLY---TRADPSCGQLLSHQEPFSNSQFNVSSVTTFLIHGY--RPTGSPPVWMKQFVEFLL 103

  Fly   101 QTQPINVISVDYG----TLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSL 161
            ..:.:|||.||:.    .:..|.     .|.|...|:..|..:|..:...| :....||:||.||
Zfish   104 NRRDMNVIVVDWNRGATNMNYWQ-----VVKNTRKVANNLTDLIQKMKDNG-ANLSSIHMIGVSL 162

  Fly   162 GAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGH 226
            ||.::|......:..:.|||.||||||.|..:|. :.:||.|||.||:.:|||.........:||
Zfish   163 GAHISGFTGANFNGEIGRITALDPAGPEFNGRPP-EDRLDPSDALFVEALHTDMDALGYRNLLGH 226

  Fly   227 ADFYPNLDQLNQRGC--SYISNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDF---FSQR 286
            .|:|.| ...:|.||  :.:|...::.|:|.|:...|..|:.......|..|..:.||   ....
Zfish   227 IDYYAN-GGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMD 290

  Fly   287 CSHYSNMPNTQMGY--------FVSEDASGSYFLTTHEVAPFAK 322
            |..:.:......||        .|..:.:.:|| .|::.:||.|
Zfish   291 CGKFKSAGCPIFGYDSVRWRDTLVQLEQTRTYF-QTNKASPFCK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 84/295 (28%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 84/296 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.