DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG5665

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:243 Identity:71/243 - (29%)
Similarity:104/243 - (42%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 INVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLI------------ 157
            :|.:.||....|  ..:|.|:..|..::.|.:...:.:||.  ::...:||||            
  Fly   149 VNFVIVDAADYV--DTFYAWSALNTDLIGEHIGVGLTHLIE--LTPLRNIHLIGGFIKESFVSIN 209

  Fly   158 -------GFSLGAQVAGMVA----NYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDII 211
                   |.||||.:.|...    ....:.:.||||||||.|.|..:..| ..|...||..||||
  Fly   210 SGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKIL-PGLTRGDAKLVDII 273

  Fly   212 HTDPFFFSMLPPMGHADFYPNLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESII--SERGFWAQ 274
            ||:....:...|:|..||||......|.||..|      .|:|.||..|:.||..  .|:.|..:
  Fly   274 HTNIGILAKRGPLGDVDFYPGGAHPIQPGCLTI------GCSHTRAVEYFAESAYPHQEKNFMGK 332

  Fly   275 QCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322
            :|..|.:...:.||.....|   |||.::..|.|.|::..:...|:.:
  Fly   333 KCASWDELRKRDCSAGIVSP---MGYRMNPQARGIYYVDVNGWPPYGR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 70/235 (30%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.