DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and LPL

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:302 Identity:84/302 - (27%)
Similarity:134/302 - (44%) Gaps:48/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ILIHGFIGN---RNLTPNLEVRDVLLQTQP-INVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQ 138
            ::|||:...   .:..|.|..  .|.:.:| .|||.||:  |.|...:||.:.....:|.:.:|:
Human    77 MVIHGWTVTGMYESWVPKLVA--ALYKREPDSNVIVVDW--LSRAQEHYPVSAGYTKLVGQDVAR 137

  Fly   139 MINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGF--MMQPSLQQKLD 201
            .||.:........:::||:|:||||..||:..:..::.:.||||||||||.|  ...||   :|.
Human   138 FINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPS---RLS 199

  Fly   202 ASDADFVDIIHTDPFFFSMLP--------PMGHADFYPN-------------LDQLNQRGCSYIS 245
            ..||||||::||   |....|        |:||.|.|||             :..:.:||...:.
Human   200 PDDADFVDVLHT---FTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVD 261

  Fly   246 NWRFYNCNHYRAAVYYGESIISERG-FWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSE---DA 306
              :...|:|.|:...:.:|:::|.. ..|.:|.....|....|..........:||.:::   ..
Human   262 --QLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKR 324

  Fly   307 SGSYFLTTHEVAPFAKGPL-VEVEFDVSELRNFT----EIEL 343
            |...:|.|....|:..... |::.|..:|....|    ||.|
Human   325 SSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 76/268 (28%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53
Lipase 33..473 CDD:332983 84/302 (28%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 2/24 (8%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.