DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG10116

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:328 Identity:92/328 - (28%)
Similarity:140/328 - (42%) Gaps:65/328 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLLTIVSGFCKGENHTRGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDD--PIQLDPLNPQKDV 69
            |.|.|||.:                 |.||       ..|:|.|.:.:::  ||:.:.....:..
  Fly     9 LFLTLTIAA-----------------VYGE-------TGFFLNTRRVQENAQPIEAEVEALVRSS 49

  Fly    70 FQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSE 134
            |....|..:.|..::||.:......|....||.|..|:||||..           ..|:...:.:
  Fly    50 FYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLS-----------EANDETEIID 103

  Fly   135 CLAQMI---NNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLAR----ITGLDPAGPGFMM 192
            .:|.::   :|.....:.|   |.::||:.||.:||.||..|.|.|.|    ||.|||:...   
  Fly   104 SVASLVIVLHNQFDMPLDR---ILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPSSGA--- 162

  Fly   193 QPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCSYISNWRFYNCNHYRA 257
              .|..||..:||:||:::||:.........:||.|:|||..| .|.||:..|      |:|.||
  Fly   163 --ELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQ-TQPGCTTDS------CSHERA 218

  Fly   258 AVYYGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSED--ASGSYFLTTHEVAPF 320
            .....|....|..|.:.:||......:..|...::    :||....|:  |||.|||.|.:.:||
  Fly   219 FELLAEMWSPENDFVSARCGSVETLSASSCRWSTH----KMGQKQEEEQPASGIYFLETRQSSPF 279

  Fly   321 AKG 323
            ::|
  Fly   280 SRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 81/282 (29%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 80/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.