DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and lipg

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:292 Identity:89/292 - (30%)
Similarity:138/292 - (47%) Gaps:34/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FQPRLPLKILIHGFIGNRNLTPNLE------VRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNN 128
            |...|...::|||:    .::...|      |..|..:....||:.||:..|...  .||.|||:
Zfish    83 FNATLRTILIIHGW----TMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQ--LYPDAVNH 141

  Fly   129 APIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQ 193
            ...|.:.:|.:::.|......:.|::|:||:||||.|||....:|:..:.||||||||||.|...
Zfish   142 TRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGIIGRITGLDPAGPMFEGA 206

  Fly   194 PSLQQKLDASDADFVDIIHTDP-----FFFSMLPPMGHADFYPNLDQLNQRGCSY-----ISNWR 248
            .| ..||...||||||::||..     ....:..|:||.|.|||...: |.||::     .::..
Zfish   207 DS-YNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDV-QPGCTFGEFLSAASGN 269

  Fly   249 F---YNCNHYRAAVYYGESIIS-ERGFWAQQCGGWFDFFSQRC-SHYSNMPNTQMGY---FVSED 305
            |   ..|.|.||...:.:|::: :...:|.||.|...|....| |...|..|: :||   .:.:.
Zfish   270 FMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNS-IGYNAKKMRKR 333

  Fly   306 ASGSYFLTTHEVAPFAKGPLVEVEFDVSELRN 337
            .:...:|.|....||. |...:::..|.:.:|
Zfish   334 RNSKMYLKTRADTPFG-GYHYQMKMHVFDRKN 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 84/269 (31%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 89/292 (30%)
Pancreat_lipase_like 65..344 CDD:238363 84/269 (31%)
PLAT_LPL 351..486 CDD:238856 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.