DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG13562

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:151 Identity:35/151 - (23%)
Similarity:62/151 - (41%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVSFWLYTNQTRDDPIQLDPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQPINV 107
            :|.|:....:|.:.....|..:.......|.....|::||:|.:.:....|.:.:.|...:...|
  Fly    62 KVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCV 126

  Fly   108 ISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANY 172
            |.:||..:.  ...|.....|...::..::.:|..|...|...:.. ::.|||.|.|:|..|...
  Fly   127 ICIDYSVVA--SSSYMRLYTNFDTLTGAISSIILTLFRQGFDPKRG-YMFGFSFGGQLASAVGRS 188

  Fly   173 VSQP---LARITGLDPAGPGF 190
            : :|   :..|...|.|||||
  Fly   189 L-RPHHIIESIDTCDMAGPGF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 35/150 (23%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.