DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG14034

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:305 Identity:124/305 - (40%)
Similarity:173/305 - (56%) Gaps:22/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CPNSRVSFWLYTNQTRDDPIQLDPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQ 103
            |||:.:||||||.:.::. .:|......:..|....|||:|||||.|:|:.:||.::|.:.| ||
  Fly    33 CPNANISFWLYTKENQEG-TKLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFL-TQ 95

  Fly   104 PINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGM 168
            ..|:||:||..|...|||.. ||:||..|:.|.||::..|:.:|:.:.||:||||..|||.|||.
  Fly    96 DYNLISLDYPKLAYEPCYTE-AVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGF 159

  Fly   169 VANYVSQ-PLARITGLDPAGPGFMMQ-PSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYP 231
            :..::.: .|..||.||||.|.:|:: |:|  |||.:||.|||::|||.....:|..:||.|||.
  Fly   160 IGQFLPEHKLEHITALDPAKPFYMVKDPAL--KLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYL 222

  Fly   232 NLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNT 296
            |:. ::|..|..|:....:.|.|.|||.||.|||.|..||:...|..:..|....|....|:  .
  Fly   223 NMG-VSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNI--E 284

  Fly   297 QMGYFVSEDASGSYFLTTHEVAPFAKGPLVEVEFDVSELRNFTEI 341
            .||:.|...|.|.|||.|:...|:|||            .|||.|
  Fly   285 LMGFHVDPKARGRYFLDTNNGPPYAKG------------ENFTSI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 113/273 (41%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 112/273 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D139550at50557
OrthoFinder 1 1.000 - - FOG0008540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.