DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Yp1

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:246 Identity:71/246 - (28%)
Similarity:104/246 - (42%) Gaps:43/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EVRDVLLQTQPINVISVDYGTLVRWPCYYPWAV----NNAPIVSECLAQMINNLISAGISRREDI 154
            ||::.  :||..::|.:|.|:.:.  .|..:|:    .....:.:.:.||:|.|...    .:.|
  Fly   193 EVKNA--KTQSGDIIVIDLGSKLN--TYERYAMLDIEKTGAKIGKWIVQMVNELDMP----FDTI 249

  Fly   155 HLIGFSLGAQVAGMVA----NYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDP 215
            ||||.::||.|||..|    ......|.|:|||||:......:.:| ..|...||:|||.|||. 
  Fly   250 HLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTL-TGLARGDAEFVDAIHTS- 312

  Fly   216 FFFSMLPPM--GHADFYPNLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESII--SERGFWAQQC 276
             .:.|..|:  |..|||||.......|.|.:.....      ||..|:.||:.  :||.|.|...
  Fly   313 -VYGMGTPIRSGDVDFYPNGPAAGVPGASNVVEAAM------RATRYFAESVRPGNERSFPAVPA 370

  Fly   277 GG-----WFDFFSQRCSHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322
            ..     ..|.|.:|         ..||...:.|..|.|.|..:..:||.:
  Fly   371 NSLQQYKQNDGFGKR---------AYMGIDTAHDLEGDYILQVNPKSPFGR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 69/238 (29%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.