DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG5966

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:335 Identity:96/335 - (28%)
Similarity:152/335 - (45%) Gaps:52/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VGEQKCPNSRVSFWLYTNQTRDDPIQLDPLNPQKDV----FQPRLPLKILIHGFIGNRNLTPNLE 94
            |..||.......|.|:|.:..|.|..|| ||..:.|    ..|:..:.:|:||::.:..:....:
  Fly    68 VHPQKPSEIEPHFTLHTRRALDQPKYLD-LNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWD 131

  Fly    95 VRDVLLQTQP---INVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLI-SAGISRREDIH 155
            :...||..:|   .:|:.:|:|.....|  |..||.|..:|....|.:::.|. ...:...:::|
  Fly   132 MAKALLAHEPEGRASVVLIDWGGGASPP--YVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVH 194

  Fly   156 LIGFSLGAQVAGMVANYVSQPL----ARITGLDPAGPGFM-MQPSLQQKLDASDADFVDIIHTD- 214
            :||.||||.::|....::....    |||||||||.|.|. ..|.:  :||.:||.||||:||| 
  Fly   195 IIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIV--RLDKTDAHFVDIVHTDA 257

  Fly   215 -PFF---FSMLPPMGHADFYPNLDQLNQRGCS------------YISNWRFYNCNHYRAAVYYGE 263
             |..   ..:...:||.||:|| ...:..||:            :::...|..|||.|:..|:.|
  Fly   258 NPLMKGGLGINMRLGHVDFFPN-GGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTE 321

  Fly   264 SIISERGFWAQQCGGWFDFFSQRCSHYSNMPNT--QMGYFVSE--------------DASGSYFL 312
            ||.|:..|....|..:..|...:|:......:|  :|||...|              |:.|.::|
  Fly   322 SIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYL 386

  Fly   313 TTHEVAPFAK 322
            .|.:..||.:
  Fly   387 WTGDSKPFCR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 91/317 (29%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 94/331 (28%)
Pancreat_lipase_like 76..390 CDD:238363 91/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.