DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Lipg

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:124/276 - (44%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LIHGFIGN-------RNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECL 136
            :|||:..:       ..|...|:.|:     :..||:.||:..|...  .|..||:|..:|...:
  Rat    90 IIHGWTMSGMFESWLHKLVSALQTRE-----KEANVVVVDWLPLAHQ--LYIDAVSNTRVVGRRV 147

  Fly   137 AQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLD 201
            |.|:|.|...|.....|:||||:||||.|||...|:|...:.||||||||||.| ....:.::|.
  Rat   148 AGMLNWLQEKGEFSLGDVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMF-EGVDINRRLS 211

  Fly   202 ASDADFVDIIHTDPFFFSM----LPPMGHADFYPNLDQLNQRGCSY-----------ISNWRFYN 251
            ..||||||::||....|.:    ..|:||.|.|||.... |.||.:           ||  ....
  Rat   212 PDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDF-QPGCGFNDVMGSFAYGTIS--EMVK 273

  Fly   252 CNHYRAAVYYGESIIS-ERGFWAQQC--------GGWFDFFSQRCSHYSNMPNTQMGY---FVSE 304
            |.|.||...:.:|::: ::..:|.||        |........||::        :||   .:.:
  Rat   274 CEHERAVHLFVDSLVNQDKPSFAFQCTDPNRFKRGICLSCRKNRCNN--------IGYNAKKMRK 330

  Fly   305 DASGSYFLTTHEVAPF 320
            ..:...:|.|....||
  Rat   331 KRNSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 83/270 (31%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 83/270 (31%)
lipo_lipase 53..488 CDD:132274 85/276 (31%)
Heparin-binding. /evidence=ECO:0000250 327..339 0/11 (0%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.