DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Lpl

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:273 Identity:80/273 - (29%)
Similarity:121/273 - (44%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ILIHGFIGN---RNLTPNLEVRDVLLQTQP-INVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQ 138
            ::|||:...   .:..|.|..  .|.:.:| .|||.||:  |.|...:||.:.....:|...:|:
  Rat    77 VVIHGWTVTGMYESWVPKLVA--ALYKREPDSNVIVVDW--LYRAQQHYPVSAGYTKLVGNDVAR 137

  Fly   139 MINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGF--MMQPSLQQKLD 201
            .||.|........:::||:|:||||..||:..:..::.:.||||||||||.|  ...||   :|.
  Rat   138 FINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPS---RLS 199

  Fly   202 ASDADFVDIIHTDPFFFSMLP--------PMGHADFYPNLDQLNQRGCSYISNWR---------- 248
            ..||||||::||   |....|        |:||.|.|||.... |.||:.....|          
  Rat   200 PDDADFVDVLHT---FTRGSPGRSIGIQKPVGHVDIYPNGGTF-QPGCNIGEAIRVIAEKGLGDV 260

  Fly   249 --FYNCNHYRAAVYYGESIISERG-FWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSE---DAS 307
              ...|:|.|:...:.:|:::|.. ..|.:|.....|....|..........:||.:::   ..|
  Rat   261 DQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLSCRKNRCNNVGYEINKVRAKRS 325

  Fly   308 GSYFLTTHEVAPF 320
            ...:|.|....|:
  Rat   326 SKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 79/267 (30%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 80/273 (29%)
Pancreat_lipase_like 37..334 CDD:238363 79/267 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 2/22 (9%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.