DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and LIPH

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:327 Identity:99/327 - (30%)
Similarity:151/327 - (46%) Gaps:61/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EQKCPN-SRVSF-------------WLYT--NQTRDDPIQ---LDPLNPQKDVFQPRLPLKILIH 81
            |:.||: :|:||             .|||  |.|....|.   ...||..|..       ..::|
Human    19 EETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKT-------TFIVH 76

  Fly    82 GFIGNRNLTPNLEVRDV---LLQTQPINVISVDYG----TLVRWPCYYPWAVNNAPIVSECLAQM 139
            ||  ....:|.:.:.|:   ||..:.:||:.||:.    ||:     |..|.:....|:..|.:.
Human    77 GF--RPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLI-----YTHASSKTRKVAMVLKEF 134

  Fly   140 INNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASD 204
            |:.:::.|.| .:||::||.||||.::|.|.......|.||||||||||.|..:|. |.:||.||
Human   135 IDQMLAEGAS-LDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPH-QDRLDPSD 197

  Fly   205 ADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGC--SYISNWRFYNCNHYRAAVYYGESIIS 267
            |.|||:||:|........|:|:.||||| ..|:|.||  :.:..::::.|:|.|:...|..|:..
Human   198 AQFVDVIHSDTDALGYKEPLGNIDFYPN-GGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRE 261

  Fly   268 ERGFWAQQCGGWFDFFSQRC-----SHYSNMPNTQMGYFV---------SEDASGSYFLTTHEVA 318
            .....|..|..:.|:.:.:|     |...:.|  .:||:.         .:......|..|.|.:
Human   262 SCTITAYPCDSYQDYRNGKCVSCGTSQKESCP--LLGYYADNWKDHLRGKDPPMTKAFFDTAEES 324

  Fly   319 PF 320
            ||
Human   325 PF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 92/312 (29%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 88/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.