DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Lipg

DIOPT Version :9

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:279 Identity:84/279 - (30%)
Similarity:129/279 - (46%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LIHGFIGN-------RNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECL 136
            :|||:..:       ..|...|::|:     :..||:.||:..|...  .|..||||..:|.:.:
Mouse    88 IIHGWTMSGMFESWLHKLVSALQMRE-----KDANVVVVDWLPLAHQ--LYTDAVNNTRVVGQRV 145

  Fly   137 AQMINNL-----ISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSL 196
            |.|::.|     .|.|     ::||||:||||.|||...|:|...:.||||||||||.| ....:
Mouse   146 AGMLDWLQEKEEFSLG-----NVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMF-EGVDI 204

  Fly   197 QQKLDASDADFVDIIHTDPFFFSM----LPPMGHADFYPNLDQLNQRGCSY---ISNWRF----- 249
            .::|...||||||::||....|.:    ..|:||.|.|||.... |.||.:   |.::.:     
Mouse   205 NRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDF-QPGCGFNDVIGSFAYGTISE 268

  Fly   250 -YNCNHYRAAVYYGESIIS-ERGFWAQQC--------GGWFDFFSQRCSHYSNMPNTQMGY---F 301
             ..|.|.||...:.:|::: ::..:|.||        |........||::        :||   .
Mouse   269 MVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSSRFKRGICLSCRKNRCNN--------IGYNAKK 325

  Fly   302 VSEDASGSYFLTTHEVAPF 320
            :.:..:...:|.|....||
Mouse   326 MRKKRNSKMYLKTRAGMPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 82/273 (30%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 82/273 (30%)
lipo_lipase 51..485 CDD:132274 84/279 (30%)
Heparin-binding. /evidence=ECO:0000250 325..337 0/11 (0%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.