powered by:
Protein Alignment CG34260 and CG33725
DIOPT Version :9
Sequence 1: | NP_001262120.1 |
Gene: | CG34260 / 5740551 |
FlyBaseID: | FBgn0085289 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027125.1 |
Gene: | CG33725 / 3772600 |
FlyBaseID: | FBgn0053725 |
Length: | 181 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 17/71 - (23%) |
Similarity: | 35/71 - (49%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 VKFSLNQTIEH--FDVLATFDLIKKDKS-RMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSN 118
|..:.|.|:.| .:::....|.||... :..:.|:|:|.|:::.:.: :..|..:|...|..|.
Fly 57 VLLNFNGTVLHPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNF-HPFVRIIFDLFKDFST 120
Fly 119 LPDSCP 124
:..:||
Fly 121 INHTCP 126
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.