DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34260 and CG33725

DIOPT Version :9

Sequence 1:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:71 Identity:17/71 - (23%)
Similarity:35/71 - (49%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VKFSLNQTIEH--FDVLATFDLIKKDKS-RMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSN 118
            |..:.|.|:.|  .:::....|.||... :..:.|:|:|.|:::.:.: :..|..:|...|..|.
  Fly    57 VLLNFNGTVLHPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRTNF-HPFVRIIFDLFKDFST 120

  Fly   119 LPDSCP 124
            :..:||
  Fly   121 INHTCP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 13/53 (25%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.