DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34260 and CG33644

DIOPT Version :9

Sequence 1:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:158 Identity:40/158 - (25%)
Similarity:72/158 - (45%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DIAIKTLGCQIIAKAYVNSLECLLVRQR----TAVVAVKFSLNQTIEHFDVLATFDL-IKKDKSR 83
            |.::..:.|.|.:..||.:..|.|.::.    :...:.:|||.:.:.  ||...:.. .|:.||.
  Fly     2 DASMTQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVN--DVRGAYVFSFKQGKSI 64

  Fly    84 MNIADIKIDGCKYLGSMYQNNIVGKLF-KRLKSVSNLPDSCPVSKGKLYEIRNYTFISDEFPPGA 147
            :|...::||.|:.|.:: |:.|:.||. ..|:.|||.|.:||....|.|.:..:|......|...
  Fly    65 INYTAMEIDYCQALSAL-QSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTINPKVIPSYT 128

  Fly   148 PQAKWQVRLKLLKRSELVADISIEGAVV 175
            |:..:.....:..:......::|.|.||
  Fly   129 PEMIFTSDCNIFIKKRRAMQLTIHGRVV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 24/82 (29%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.