DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Lcp65Ab2

DIOPT Version :10

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:96 Identity:23/96 - (23%)
Similarity:32/96 - (33%) Gaps:36/96 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TEEV----SWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPHG--------------NSGVVRAK 89
            ||||    ..|.|..   |.:.|||       |...:::.|:|              .||||..|
  Fly     5 TEEVRAKAEMYTGDE---ICREKTK-------CFLKEISMPNGLLPLKDIEEVGYDRESGVVWLK 59

  Fly    90 FTSNLPPK--------SMGSRVRVFMYPSNI 112
            ...::..|        |.|:.|...:....|
  Fly    60 QKKSITHKFTEIDKLVSYGTEVTAIVETGKI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 15/73 (21%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:459790 10/51 (20%)

Return to query results.
Submit another query.