DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34461 and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:171 Identity:68/171 - (39%)
Similarity:91/171 - (53%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYFVAIALL-FAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVA---------------YP 50
            |:..|:|.: .|:|...||.    ||.:.|.||.::...||    |||               :|
  Fly     4 KFVFALAFVAVASAGYAPIA----APQVYHAAPAVATYAHA----PVAVAQKVVVKAAEEYDPHP 60

  Fly    51 KYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSK 115
            :|.|:||:.|..|||.|.|.||||||||:|:|||::.||..|.|.||||..|||||||::....|
  Fly    61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVK 125

  Fly   116 IIAHAPVL---------HAAPVLAH----------APLLHH 137
            .:|.|||:         :|||.:||          ||:.|:
  Fly   126 AVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 31/51 (61%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.